PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa006915
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 356aa    MW: 40239.2 Da    PI: 9.9034
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58686518PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.4e-32184237255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Lsa006915 184 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 237
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.68E-15181238IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28182237IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-23184238IPR006447Myb domain, plants
PfamPF002492.3E-7185236IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MELFPAQPDL SLQISLPNTK PTSTTWAAST TKQDHHDLDL GNFWKSTLNS QQHHTRPEPS  60
SGLNLPHPTH STNPDINHLH HLLSHQNINR TNLTDQNHHH LGFRSELGFL RPIKGVPVYY  120
HNTNLPKITV LSHNQHQPFL DSFCTGSTTA PTSNTPSSLI HPNNIAQSRF LSTRISSKRS  180
MRAPRMRWTT TLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTIKT  240
TDKAPASSGQ SDYLEHGLSG DTSDDILLEI QNLKRTNSSA ERKGRSMVHP EEDNQCGLWS  300
NSSREAWLHG KHKDSQINIP TLKKEIIKGM INYERLSEAN SSRMKPNLEF TLGRPQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158256.11e-107hypothetical protein PHAVU_002G137300g
SwissprotQ9C6164e-62KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A118JT661e-164A0A118JT66_CYNCS; Homeodomain-like protein (Fragment)
STRINGVIT_02s0012g01940.t011e-103(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-63G2-like family protein